LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", element.find('li').removeClass('active'); Vodafone offers concessions to secure Unitymedia takeover. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "triggerEvent" : "click", } ] "selector" : "#messageview_3", "quiltName" : "ForumMessage", "initiatorBinding" : true, { } var handleClose = function(event) { "action" : "rerender" "context" : "", "action" : "rerender" } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/205317","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mzOLigjVoDlp-V2oztUScWsfdbcvnsMBW8wRg0AUv3s. { "context" : "envParam:feedbackData", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2396624 .lia-rating-control-passive', '#form_0'); ] } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", }); ], { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ // --> } ] } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2400204 .lia-rating-control-passive', '#form_3'); }, } "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" "event" : "MessagesWidgetEditAction", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. }, { ;(function($) { "event" : "AcceptSolutionAction", { { }, "context" : "", { { var count = 0; { "action" : "rerender" } "context" : "", "context" : "", { } }, "event" : "MessagesWidgetEditAnswerForm", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BEm8PELQqopLBA48xPdTaOROvyoK0pRSOzUGqigivYo. }); }, Unitymedia Retourenschein Vodafone Retourenschein Ausdrucken Pdf / Vodafone widerruf retoure, vodafone runners: profiteer nu ... : Bitte fülle diesen retourenschein vollständig aus.. Also da kann ich nur. "action" : "rerender" { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "context" : "", "disableKudosForAnonUser" : "false", "actions" : [ ] "selector" : "#messageview_1", ] "action" : "rerender" }, { "actions" : [ { } ] "context" : "", "context" : "", } { "actions" : [ "event" : "MessagesWidgetAnswerForm", { ] }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", $(document).ready(function(){ ] count = 0; "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", } } { LITHIUM.Dialog({ LITHIUM.Loader.runJsAttached(); ] }, }, LITHIUM.Dialog({ var handleOpen = function(event) { { { }, "context" : "envParam:quiltName", } } Betreff: Widerruf TV (Unitymedia) ‎17.08.2020 22:03 Zu den einzelnen Programmpaketen gibt es jeweils eine genaue Dokumentation - auch online - , welche Programme in den jeweiligen TV Abo … return; "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "action" : "rerender" "action" : "rerender" "includeRepliesModerationState" : "false", Unitymedia Widerruf - Vorlage Deutsch: Sie haben sich umentschieden und wollen kurzfristig Ihren Unitymedia Vertrag widerrufen? LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BEm8PELQqopLBA48xPdTaOROvyoK0pRSOzUGqigivYo. "action" : "rerender" LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } } else { "context" : "envParam:quiltName", { } "context" : "", "event" : "AcceptSolutionAction", { { })(LITHIUM.jQuery); "context" : "", "actions" : [ "action" : "rerender" { "action" : "rerender" }, var expireDate = new Date(); Damit Du es bald noch leichter hast, arbeiten wir an einem gemeinsamen Service-Portal. } ] { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", $(this).next().toggle(); }, "event" : "kudoEntity", as-block: AS20485 - AS20857 descr: RIPE NCC ASN block remarks: These AS Numbers are assigned to network operators in the RIPE NCC service region. "event" : "addMessageUserEmailSubscription", "actions" : [ }, { "action" : "rerender" ] { "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", { "disableKudosForAnonUser" : "false", "actions" : [ Red Cable 1000 - nur 1 mb/s Download-Geschwindigke... Kundennummer existiert nicht?! "event" : "unapproveMessage", // Oops. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2396624,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZUA1UNBBgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcBApQAFcDAxQGUVQPSQEGA1RID1MKBU9XBgYAUAxTVgQAClFAThUPVn1bVgB\/AhsIQFMFVwEGAhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "event" : "addMessageUserEmailSubscription", { }, } { logmein: [76, 79, 71, 77, 69, 73, 78], "quiltName" : "ForumMessage", } "actions" : [ "actions" : [ "context" : "envParam:feedbackData", }, { { { }, { } { ] "displaySubject" : "true", }, Bist du sicher, dass du fortfahren möchtest? "kudosLinksDisabled" : "false", }, "}); "actions" : [ "event" : "MessagesWidgetEditAction", } ] "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'Rwdnyb9E2V4i8NX6VSWF0EBSIfMshSs5ToHsufmxlq4. }); ] { ] { }); { { } "event" : "markAsSpamWithoutRedirect", In diesem Artikel haben wir für dich zusammengefasst, wie Kündigung, Widerruf und Sonderkündigung bei cablesurf funktionieren, und was du noch alles beachten musst. { { Hier die Adresse für deine Unitymedia Reklamation: Vodafone West GmbH Aachener Str. }, { Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland. }, "}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2397114,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ createStorage("false"); Vodafone Germany has announced that it is withdrawing the Unitymedia brand from the market. ] }, "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" }, "disableLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'JDFAXlGlBHeuIf2z4jUllLv1kOzRA78PxyXWTG9DkNo. } "event" : "kudoEntity", }, { { ] "action" : "pulsate" "actions" : [ "showCountOnly" : "false", "context" : "", "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { }, .attr('aria-expanded','true') "parameters" : { LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; EU approval of Vodafone/Unitymedia cable deal faces legal action. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, ] "context" : "", LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; Emil Und Die Detektive Kapitel 11, Regel Plural Deutsch, Studentische Hilfskraft Hannover, Danke Für Ihr Verständnis Synonym, Wo Begegnet Uns Musik, Ffxiv Crafting Material, Dr Engel Hno Arzt, Nanny Mcphee Ganzer Film Deutsch Kostenlos, Danke Für Ihr Verständnis Synonym, Scholz Coesfeld Praktikum, Sv 03 Tigers Tübingen Basketball, Kia Ceed Software Update 2020, Regel Plural Deutsch, " />

} "initiatorBinding" : true, "parameters" : { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.ComponentEvents.set({ { { ] { ] "action" : "rerender" "action" : "rerender" } "action" : "rerender" { { "revokeMode" : "true", "action" : "rerender" "event" : "ProductMessageEdit", "eventActions" : [ "eventActions" : [ 834 talking about this. "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2396696 .lia-rating-control-passive', '#form_1'); "truncateBodyRetainsHtml" : "false", } "action" : "rerender" }, $('.lia-button-wrapper-searchForm-action').removeClass('active'); { "context" : "", { "context" : "envParam:quiltName", "event" : "expandMessage", "actions" : [ "}); // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" "disableKudosForAnonUser" : "false", { } Dort kannst Du einfach online Deinen Vertrag widerrufen oder einen kostenlosen Rücksendeschein ausdrucken, wenn Du uns ein Gerät zurückschicken willst. "event" : "MessagesWidgetEditAction", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductAnswerComment", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { "action" : "rerender" return; "disableLinks" : "false", { } "selector" : "#kudosButtonV2_1", "messageViewOptions" : "1111110111111111111110111110100101001101" return; "context" : "", "displaySubject" : "true", } else { { ] "action" : "rerender" LITHIUM.Dialog.options['1216436912'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ... Das Widerrufsrecht gilt nicht für Verträge, die Du vor Ort in einem Vodafone-Shop abgeschlossen hast. LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "context" : "", "event" : "QuickReply", "context" : "", "actions" : [ { { "actions" : [ { ] "action" : "rerender" $(document).ready(function() { "includeRepliesModerationState" : "false", "kudosLinksDisabled" : "false", LITHIUM.Dialog.options['1764386760'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); ], { "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233344}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'Rwdnyb9E2V4i8NX6VSWF0EBSIfMshSs5ToHsufmxlq4. "parameters" : { } var keycodes = { { ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "messageViewOptions" : "1111110111111111111110111110100101001101" logmein: [76, 79, 71, 77, 69, 73, 78], { "disableLinks" : "false", "context" : "", }, }); "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ { "action" : "rerender" } Tage nach Vertragsabschluss. "context" : "", { "event" : "ProductMessageEdit", "context" : "", }); "action" : "rerender" "action" : "rerender" Vodafone übernimmt Unitymedia - so der Plan. "buttonDialogCloseAlt" : "Schließen", ', 'ajax'); } $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "event" : "markAsSpamWithoutRedirect", "event" : "removeMessageUserEmailSubscription", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "context" : "envParam:entity", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } }, "useSimpleView" : "false", } { Bitte denk dran: Für Verträge, die im Fachhandel oder in einem unserer Shops geschlossen wurden, besteht kein Widerrufsrecht. ], ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", if(do_scroll == "true"){ "}); "action" : "rerender" "linkDisabled" : "false" "disableLinks" : "false", { $(this).removeAttr('href'); "initiatorBinding" : true, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "editProductMessage", "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", } "context" : "", }, "context" : "envParam:entity", ] }, "action" : "pulsate" "actions" : [ $(this).toggleClass('active'); }, LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "useCountToKudo" : "false", "action" : "rerender" ] "action" : "rerender" { ;(function($) { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", ] "initiatorDataMatcher" : "data-lia-kudos-id" { }, } "context" : "", }, { "context" : "envParam:selectedMessage", "actions" : [ ] "actions" : [ }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", ] } else { count = 0; "action" : "rerender" Vodafone darf den Kabelnetzbetreiber Unitymedia übernehmen. "context" : "envParam:quiltName", ich wollte noch TV paket haben. } Meine Hardware sowie meine Auftragsbestätigung habe ich am 05.03.2019 erhalten. Schick uns das Widerrufsformular innerhalb von 14 Tagen an widerruf@unitymedia.de. "actions" : [ ] $(this).addClass('active') { { ;(function($) { "activecastFullscreen" : false, "initiatorDataMatcher" : "data-lia-kudos-id" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "initiatorBinding" : true, }, }, { "context" : "", { "context" : "envParam:quiltName", "linkDisabled" : "false" "eventActions" : [ "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "rerender" }); "event" : "ProductMessageEdit", { "actions" : [ }); "revokeMode" : "true", "actions" : [ { "actions" : [ } } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); { { "actions" : [ }, "event" : "addMessageUserEmailSubscription", "event" : "MessagesWidgetEditAction", "eventActions" : [ ] // just for convenience, you need a login anyways... "quiltName" : "ForumMessage", ] "action" : "rerender" } "actions" : [ } }, "event" : "MessagesWidgetAnswerForm", { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/205317","ajaxErrorEventName":"LITHIUM:ajaxError","token":"sdY9ZdOyF_yk-Z0z4UKk9Y4OkoozD9D1SD_N9a_CVZU. }); } // Oops, not the right sequence, lets restart from the top. "action" : "pulsate" "context" : "", } "displaySubject" : "true", }, ], } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); //$('#community-menu-toggle').removeClass('active') }, ] } "action" : "pulsate" On 2007, Unity Media began to referred itself as Unitymedia. var key = e.keyCode; ] { }); LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "disableKudosForAnonUser" : "false", "action" : "rerender" })(LITHIUM.jQuery); "actions" : [ { Unitymedia), die DAZN Channels, die internationalen TV-Pakete, die entsprechenden Vorgängerpakete (HD Premium, Allstars, Kabel Digital Home etc.) "event" : "expandMessage", }, }, element.siblings('li').removeClass('active'); watching = false; { ;(function($) { "context" : "envParam:quiltName,message", "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ window.location.replace('/t5/user/userloginpage'); "event" : "kudoEntity", { var count = 0; }, Der Speedtest Plus von Vodafone liefert Dir einfach und schnell Deine aktuelle Download- & Upload-Geschwindigkeit sowie Ping Latenzen. "event" : "MessagesWidgetEditAction", "event" : "RevokeSolutionAction", "action" : "pulsate" { ;(function($) { "triggerEvent" : "click", "action" : "rerender" LITHIUM.Dialog({ { { { $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ Muendliche Nebenabreden mit einem Vermittler von Vertraegen sind nicht gueltig. "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2396696,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" }, LITHIUM.AjaxSupport.ComponentEvents.set({ } ] } "closeEvent" : "LITHIUM:lightboxCloseEvent", } "actions" : [ "actions" : [ "action" : "rerender" { "truncateBody" : "true", Dazu haben wir Ihnen unten nochmals die Kontaktdaten für Ihren Unitymedia Widerruf zusammengestellt. } } "event" : "removeThreadUserEmailSubscription", ] { count = 0; }, ] LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); // --> LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "context" : "", element.find('li').removeClass('active'); Vodafone offers concessions to secure Unitymedia takeover. "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "triggerEvent" : "click", } ] "selector" : "#messageview_3", "quiltName" : "ForumMessage", "initiatorBinding" : true, { } var handleClose = function(event) { "action" : "rerender" "context" : "", "action" : "rerender" } { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/205317","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mzOLigjVoDlp-V2oztUScWsfdbcvnsMBW8wRg0AUv3s. { "context" : "envParam:feedbackData", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2396624 .lia-rating-control-passive', '#form_0'); ] } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", }); ], { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ // --> } ] } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2400204 .lia-rating-control-passive', '#form_3'); }, } "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" "event" : "MessagesWidgetEditAction", ctaHTML += ', Angebote und Informationen für CallYa Kunden, Störungsmeldungen Internet, TV & Telefon DSL, Störungsmeldungen Internet, TV & Telefon Kabel, Störungsmeldungen Mobilfunk, CallYa & LTE, Diesen Thema für aktuellen Benutzer floaten. }, { ;(function($) { "event" : "AcceptSolutionAction", { { }, "context" : "", { { var count = 0; { "action" : "rerender" } "context" : "", "context" : "", { } }, "event" : "MessagesWidgetEditAnswerForm", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BEm8PELQqopLBA48xPdTaOROvyoK0pRSOzUGqigivYo. }); }, Unitymedia Retourenschein Vodafone Retourenschein Ausdrucken Pdf / Vodafone widerruf retoure, vodafone runners: profiteer nu ... : Bitte fülle diesen retourenschein vollständig aus.. Also da kann ich nur. "action" : "rerender" { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { "context" : "", "disableKudosForAnonUser" : "false", "actions" : [ ] "selector" : "#messageview_1", ] "action" : "rerender" }, { "actions" : [ { } ] "context" : "", "context" : "", } { "actions" : [ "event" : "MessagesWidgetAnswerForm", { ] }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", $(document).ready(function(){ ] count = 0; "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", } } { LITHIUM.Dialog({ LITHIUM.Loader.runJsAttached(); ] }, }, LITHIUM.Dialog({ var handleOpen = function(event) { { { }, "context" : "envParam:quiltName", } } Betreff: Widerruf TV (Unitymedia) ‎17.08.2020 22:03 Zu den einzelnen Programmpaketen gibt es jeweils eine genaue Dokumentation - auch online - , welche Programme in den jeweiligen TV Abo … return; "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "action" : "rerender" "action" : "rerender" "includeRepliesModerationState" : "false", Unitymedia Widerruf - Vorlage Deutsch: Sie haben sich umentschieden und wollen kurzfristig Ihren Unitymedia Vertrag widerrufen? LITHIUM.Auth.CHECK_SESSION_TOKEN = 'BEm8PELQqopLBA48xPdTaOROvyoK0pRSOzUGqigivYo. "action" : "rerender" LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } } } else { "context" : "envParam:quiltName", { } "context" : "", "event" : "AcceptSolutionAction", { { })(LITHIUM.jQuery); "context" : "", "actions" : [ "action" : "rerender" { "action" : "rerender" }, var expireDate = new Date(); Damit Du es bald noch leichter hast, arbeiten wir an einem gemeinsamen Service-Portal. } ] { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", $(this).next().toggle(); }, "event" : "kudoEntity", as-block: AS20485 - AS20857 descr: RIPE NCC ASN block remarks: These AS Numbers are assigned to network operators in the RIPE NCC service region. "event" : "addMessageUserEmailSubscription", "actions" : [ }, { "action" : "rerender" ] { "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", { "disableKudosForAnonUser" : "false", "actions" : [ Red Cable 1000 - nur 1 mb/s Download-Geschwindigke... Kundennummer existiert nicht?! "event" : "unapproveMessage", // Oops. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2396624,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAlAABlZUA1UNBBgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcBApQAFcDAxQGUVQPSQEGA1RID1MKBU9XBgYAUAxTVgQAClFAThUPVn1bVgB\/AhsIQFMFVwEGAhBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "event" : "addMessageUserEmailSubscription", { }, } { logmein: [76, 79, 71, 77, 69, 73, 78], "quiltName" : "ForumMessage", } "actions" : [ "actions" : [ "context" : "envParam:feedbackData", }, { { { }, { } { ] "displaySubject" : "true", }, Bist du sicher, dass du fortfahren möchtest? "kudosLinksDisabled" : "false", }, "}); "actions" : [ "event" : "MessagesWidgetEditAction", } ] "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'Rwdnyb9E2V4i8NX6VSWF0EBSIfMshSs5ToHsufmxlq4. }); ] { ] { }); { { } "event" : "markAsSpamWithoutRedirect", In diesem Artikel haben wir für dich zusammengefasst, wie Kündigung, Widerruf und Sonderkündigung bei cablesurf funktionieren, und was du noch alles beachten musst. { { Hier die Adresse für deine Unitymedia Reklamation: Vodafone West GmbH Aachener Str. }, { Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland. }, "}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2397114,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ createStorage("false"); Vodafone Germany has announced that it is withdrawing the Unitymedia brand from the market. ] }, "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); { { }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" }, "disableLinks" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'JDFAXlGlBHeuIf2z4jUllLv1kOzRA78PxyXWTG9DkNo. } "event" : "kudoEntity", }, { { ] "action" : "pulsate" "actions" : [ "showCountOnly" : "false", "context" : "", "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { }, .attr('aria-expanded','true') "parameters" : { LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; EU approval of Vodafone/Unitymedia cable deal faces legal action. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, ] "context" : "", LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"};

Emil Und Die Detektive Kapitel 11, Regel Plural Deutsch, Studentische Hilfskraft Hannover, Danke Für Ihr Verständnis Synonym, Wo Begegnet Uns Musik, Ffxiv Crafting Material, Dr Engel Hno Arzt, Nanny Mcphee Ganzer Film Deutsch Kostenlos, Danke Für Ihr Verständnis Synonym, Scholz Coesfeld Praktikum, Sv 03 Tigers Tübingen Basketball, Kia Ceed Software Update 2020, Regel Plural Deutsch,