"action" : "rerender" { "useCountToKudo" : "false", "event" : "MessagesWidgetEditAnswerForm", ] "context" : "", }, "revokeMode" : "true", "actions" : [ }, { "buttonDialogCloseAlt" : "Schließen", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } ;(function($) { "actions" : [ "}); if ( neededkeys[count] == key ) { Die oben genannten Tipps beheben die Probleme in den meisten Fällen. { "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", } "action" : "rerender" { ] "event" : "editProductMessage", "action" : "pulsate" // We're good so far. "actions" : [ ] { $(document).keydown(function(e) { "actions" : [ "actions" : [ Barist Hackescher Markt, Uni Marburg E-learning, „arnica C30“ Anwendungsgebiete, Toulouse Airport Code, Casa De Leone Hainburg Mittagstisch, Gasthof Fränkische Schweiz Obertrubach Speisekarte, Bilder Treppenaufgang Außen, Hotel Starke Brilon Speisekarte, Ernährungswissenschaften Studium Stuttgart, Online Bewerbung Stadt Wiesbaden, Ausbildung Gekündigt Arbeitsamt, Biblische Figur 5 Buchstaben, " />

} }, "defaultAriaLabel" : "", "action" : "rerender" "initiatorBinding" : true, { "displayStyle" : "horizontal", LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); { "buttonDialogCloseAlt" : "Schließen", { "event" : "ProductMessageEdit", "actions" : [ ', 'ajax'); "actions" : [ "event" : "MessagesWidgetAnswerForm", element.removeClass('active'); { } "action" : "rerender" { "action" : "rerender" { "actions" : [ LITHIUM.AjaxSupport.useTickets = false; Bist du sicher, dass du fortfahren möchtest? }); return; "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", "actions" : [ ] { { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['-892400015'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } } "actions" : [ "event" : "unapproveMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ "message" : "2092374", "message" : "2092149", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", } else { "actions" : [ "actions" : [ "context" : "", "displaySubject" : "true", "event" : "MessagesWidgetCommentForm", ] LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "includeRepliesModerationState" : "false", { "parameters" : { } { ] }, "kudosLinksDisabled" : "false", } "event" : "editProductMessage", ] } "action" : "pulsate" { "context" : "", "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "pulsate" "eventActions" : [ "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'yIbBSosb5iVA7z2rrCDxBhbZbKpA4ZRix-O-xgNCDhE. "buttonDialogCloseAlt" : "Schließen", "selector" : "#messageview_3", "event" : "MessagesWidgetAnswerForm", LITHIUM.Dialog.options['1184161782'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; count = 0; "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ] "actions" : [ ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_659311bc4a753_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "entity" : "1587377", "actions" : [ ] window.location.replace('/t5/user/userloginpage'); "disableKudosForAnonUser" : "false", { { "event" : "MessagesWidgetCommentForm", { } // Oops, not the right sequence, lets restart from the top. { "event" : "markAsSpamWithoutRedirect", { { "actions" : [ } Denn hat sich das Tablet erst ein­mal voll­ständig ent­laden, geht es in der Regel auch nicht mehr so ein­fach an. { { "event" : "MessagesWidgetEditAction", "action" : "rerender" }, ], "action" : "rerender" } "actions" : [ { { { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); if ( count == neededkeys.length ) { }, "eventActions" : [ }); { }, Mein Vodafone App „Daten können nicht geladen werd . // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" //} else { { { "kudosLinksDisabled" : "false", "context" : "", }, { "selector" : "#kudosButtonV2_0", "actions" : [ //} else { "disableKudosForAnonUser" : "false", "selector" : "#messageview_3", ] } }); } { }, }, "disallowZeroCount" : "false", }, "action" : "rerender" "initiatorBinding" : true, }); ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", $(document).ready(function() { }, "context" : "lia-deleted-state", "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Deshalb wenn der Speicher auf Ihr iPhone schon fast leer ist, kann App nicht geladen werden. "actions" : [ "action" : "rerender" }); "action" : "rerender" Im Wlan geht das alles. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "useSubjectIcons" : "true", "actions" : [ }); { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1587200 .lia-rating-control-passive', '#form'); "actions" : [ "context" : "envParam:entity", "event" : "ProductAnswerComment", "context" : "lia-deleted-state", "forceSearchRequestParameterForBlurbBuilder" : "false", }, } { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_70cc6ecfb85f21","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_70cc6ecfb85f21_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/7001/thread-id/95819&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"0f4i9Gxi7B7rI6hPKrVNYftlbuXFC84CoeWB5V0FNf4. ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "action" : "rerender" { ] }, "actions" : [ "useSimpleView" : "false", } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "action" : "rerender" { $('section.header-announcement').slideUp(); "action" : "rerender" }); "componentId" : "forums.widget.message-view", { }, "context" : "envParam:quiltName", "actions" : [ "actions" : [ { //$('#lia-body').addClass('lia-window-scroll'); { }, ;(function($) { Für das neue FTTH-Netz verlegen die Bonner 150 Kilo­meter Glas­faser­kabel und stellen 32 Glas­faser­netz­ver­teiler auf. "actions" : [ { "initiatorDataMatcher" : "data-lia-kudos-id" '; { } } { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ logmein: [76, 79, 71, 77, 69, 73, 78], }, } "context" : "envParam:feedbackData", "context" : "envParam:entity", { .attr('aria-expanded','true'); { "revokeMode" : "true", ] "disableKudosForAnonUser" : "false", "event" : "approveMessage", "action" : "rerender" ], "actions" : [ { watching = false; "action" : "rerender" }, "entity" : "1587377", { "selector" : "#messageview_2", "event" : "MessagesWidgetAnswerForm", "actions" : [ ;(function($) { ] }, ] { "event" : "RevokeSolutionAction", "action" : "rerender" "action" : "rerender" var element = $(this).parent('li'); $(document).ready(function(){ { "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '-ai13wRVtD3wzCw5XIiDUCYCF9-DWbwihA7JYscCzUQ. ] "context" : "envParam:selectedMessage", "message" : "2092155", } "actions" : [ "displaySubject" : "true", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95819","ajaxErrorEventName":"LITHIUM:ajaxError","token":"zPQnAVZW7SUj1V4velhX8XmJ6NqJRk_EEyyHEGMmGbY. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] { "}); "action" : "rerender" "event" : "expandMessage", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95819","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G814E8nl8xCRZHjrlS-C_1gWrXP8VFzTRJh_lRmsrKs. { { { }); "selector" : "#kudosButtonV2_2", "actions" : [ "action" : "rerender" "event" : "expandMessage", }); // We made it! "kudosLinksDisabled" : "false", { ] "event" : "approveMessage", "context" : "", 03. } "revokeMode" : "true", }, }, "context" : "", }, { "event" : "deleteMessage", $('.community-menu').removeClass('active') ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "displayStyle" : "horizontal", "action" : "rerender" "includeRepliesModerationState" : "false", "message" : "1587206", { { "displayStyle" : "horizontal", ] $(document).ready(function(){ "event" : "RevokeSolutionAction", "context" : "envParam:quiltName", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); $(document).keydown(function(e) { "event" : "MessagesWidgetEditAnswerForm", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetCommentForm", } } watching = false; }, "action" : "rerender" // console.log(key); } "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "expandMessage", ] "context" : "envParam:quiltName", "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); } }, "context" : "", } "selector" : "#kudosButtonV2_0", { })(LITHIUM.jQuery); Bist du sicher, dass du fortfahren möchtest? { { "}); "actions" : [ LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); ] "context" : "lia-deleted-state", }); "action" : "pulsate" "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233502}); }, } "action" : "rerender" { ', 'ajax'); "event" : "unapproveMessage", } } "action" : "rerender" } "event" : "expandMessage", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ ;(function($) { "context" : "envParam:selectedMessage", { "action" : "addClassName" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95819","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PXbqdol3M84ZQyGtJ5Wswp5inTLPTU5ndch6WmxkGS8. "context" : "envParam:quiltName", "action" : "rerender" "context" : "", ] "action" : "rerender" "quiltName" : "ForumMessage", "useSubjectIcons" : "true", LITHIUM.Dialog.options['1398877654'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'QAkk4NGCxut136EIatAlpHk9L_F8ZGPu6cjIdEvUTkw. } "parameters" : { Execute whatever should happen when entering the right sequence LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '4TS-JTwc9JGtyuPA0lcF6yOWjTdxiX2Bc2SdffZtDGo. { "context" : "envParam:feedbackData", "action" : "rerender" } }, "event" : "MessagesWidgetCommentForm", }); "action" : "pulsate" "context" : "envParam:quiltName", // Set start to true only if the first key in the sequence is pressed { }, LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. // console.log(key); "linkDisabled" : "false" ] { } } "actions" : [ { "entity" : "1587211", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885","ajaxErrorEventName":"LITHIUM:ajaxError","token":"obnRxLhDUNIU3F0vVs-BPIjlNQ4LzCuQwcRFKTYzX14. ] ] ] "disableLinks" : "false", "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetEditCommentForm", { "event" : "unapproveMessage", "action" : "rerender" "context" : "", ], }, { watching = false; { } ] { "event" : "ProductAnswer", "activecastFullscreen" : false, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1587211,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/34885","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qllS4aV15rPXQDHGZSuCcW73R4hyBajG39KxLT3YdiE. "parameters" : { "displaySubject" : "true", ] event.preventDefault(); }, } "actions" : [ // --> "action" : "rerender" { "useCountToKudo" : "false", "event" : "MessagesWidgetEditAnswerForm", ] "context" : "", }, "revokeMode" : "true", "actions" : [ }, { "buttonDialogCloseAlt" : "Schließen", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; } ;(function($) { "actions" : [ "}); if ( neededkeys[count] == key ) { Die oben genannten Tipps beheben die Probleme in den meisten Fällen. { "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", } "action" : "rerender" { ] "event" : "editProductMessage", "action" : "pulsate" // We're good so far. "actions" : [ ] { $(document).keydown(function(e) { "actions" : [ "actions" : [

Barist Hackescher Markt, Uni Marburg E-learning, „arnica C30“ Anwendungsgebiete, Toulouse Airport Code, Casa De Leone Hainburg Mittagstisch, Gasthof Fränkische Schweiz Obertrubach Speisekarte, Bilder Treppenaufgang Außen, Hotel Starke Brilon Speisekarte, Ernährungswissenschaften Studium Stuttgart, Online Bewerbung Stadt Wiesbaden, Ausbildung Gekündigt Arbeitsamt, Biblische Figur 5 Buchstaben,